Escrow service
If you buy the domain weihnachtsmarkt-winterfeldtplatz.de over the Domainname.de marketplace, you can take advantage of our domain brokerage service:
- bid history
- takeover negotiations
- escrow services
- purchase contract
- monitoring
- money transfer
- domain transfer
If not negotiated otherwise, the costs for transfer and escrow service are 10% of the gross selling price, and are usually paid by the seller.
More details here:
www.domainname.de